PRK5- HA, 2 ug

https://www.gentaur.be/web/image/product.template/2934/image_1920?unique=4a4e804

312,00 € 312.0 EUR 312,00 €

312,00 €

Not Available For Sale

    Deze combinatie bestaat niet.

    Terms and Conditions
    30-dagen geld terug garantie
    Verzending: 2-3 werkdagen

    pRK5-HA


    Catalog No. PVT11027
    Packing 2ug

     

    pRK5-HA Information
    Function: Mammal expression plasmid
    Resistance Amp
    Competent cells: DH5alpha
    Culture temperature: 37degrees centigrade
    Replicon: pUC
    Copy number: high
    Promoter: CMV

     

    pRK5-HA Multiple cloning sites

     

    pRK5-HA Sequence

    LOCUS       Exported                4727 bp ds-DNA     circular SYN 20-DEC-2017

    DEFINITION  synthetic circular DNA

    FEATURES             Location/Qualifiers

         source          1..4727

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         enhancer        14..393

                         /label=CMV enhancer

                         /note="human cytomegalovirus immediate early enhancer"

         promoter        394..597

                         /label=CMV promoter

                         /note="human cytomegalovirus (CMV) immediate early 

                         promoter"

         promoter        828..846

                         /label=SP6 promoter

                         /note="promoter for bacteriophage SP6 RNA polymerase"

         regulatory      963..972

                         /regulatory_class="other"

                         /note="vertebrate consensus sequence for strong initiation 

                         of translation (Kozak, 1987)"

         CDS             975..1001

                         /codon_start=1

                         /product="HA (human influenza hemagglutinin) epitope tag"

                         /label=HA

                         /translation="YPYDVPDYA"

         misc_feature    1001..1072

                         /label=MCS

         polyA_signal    1111..1245

                         /label=SV40 poly(A) signal

                         /note="SV40 polyadenylation signal"

         promoter        1381..1599

                         /label=SV40 promoter

                         /note="SV40 early promoter"

         rep_origin      1450..1585

                         /label=SV40 ori

                         /note="SV40 origin of replication"

         rep_origin      1848..2303

                         /direction=RIGHT

                         /label=f1 ori

                         /note="f1 bacteriophage origin of replication; arrow 

                         indicates direction of (+) strand synthesis"

         promoter        2585..2689

                         /gene="bla"

                         /label=AmpR promoter

         CDS             2690..3550

                         /codon_start=1

                         /gene="bla"

                         /product="beta-lactamase"

                         /label=AmpR

                         /note="confers resistance to ampicillin, carbenicillin, and

                         related antibiotics"

                         /translation="[TEM beta-lactamase fragment, 45 aa]

                         ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                         [TEM beta-lactamase fragment, 59 aa]

                         EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                         [TEM beta-lactamase fragment, 59 aa]

                         LIKHW"

         rep_origin      3721..4310

                         /direction=RIGHT

                         /label=ori

                         /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                         replication"

    ORIGIN

            1 ttcgagctcg cccgacattg attattgact agttattaat agtaatcaat tacggggtca

           61 ttagttcata gcccatatat ggagttccgc gttacataac ttacggtaaa tggcccgcct

          121 ggctgaccgc ccaacgaccc ccgcccattg acgtcaataa tgacgtatgt tcccatagta

          181 acgccaatag ggactttcca ttgacgtcaa tgggtggagt atttacggta aactgcccac

          241 ttggcagtac atcaagtgta tcatatgcca agtacgcccc ctattgacgt caatgacggt

          301 aaatggcccg cctggcatta tgcccagtac atgaccttat gggactttcc tacttggcag

          361 tacatctacg tattagtcat cgctattacc atggtgatgc ggttttggca gtacatcaat

          421 gggcgtggat agcggtttga ctcacgggga tttccaagtc tccaccccat tgacgtcaat

          481 gggagtttgt tttggcacca aaatcaacgg gactttccaa aatgtcgtaa caactccgcc

          541 ccattgacgc aaatgggcgg taggcgtgta cggtgggagg tctatataag cagagctcgt

          601 ttagtgaacc gtcagatcgc ctggagacgc catccacgct gttttgacct ccatagaaga

          661 caccgggacc gatccagcct ccgcggccgg gaacggtgca ttggaacgcg gattccccgt

          721 gccaagagtg acgtaagtac cgcctataga gtctataggc ccaccccctt ggcttcgtta

          781 gaacgcggct acaattaata cataacctta tgtatcatac acatacgatt taggtgacac

          841 tatagaataa catccacttt gcctttctct ccacaggtgt ccactcccag gtccaactgc

          901 acctcggttc tatcgattga attcccgaac cgacagtcgg tctcttcacc aaggccattc

          961 gcgccaccat gggctacccc tatgatgtgc ctgactacgc agatctcaat ggtggtggtg

         1021 gtgggtcgac gtacccgggc gtcaagcttg ctagatatcc gcatgcggcc gctaagtaag

         1081 taaggatccc cagcttggcc gccatggccc aacttgttta ttgcagctta taatggttac

         1141 aaataaagca atagcatcac aaatttcaca aataaagcat ttttttcact gcattctagt

         1201 tgtggtttgt ccaaactcat caatgtatct tatcatgtct ggatcgggaa ttaattcggc

         1261 gcagcaccat ggcctgaaat aacctctgaa agaggaactt ggttaggtac cttctgaggc

         1321 ggaaagaacc agctgtggaa tgtgtgtcag ttagggtgtg gaaagtcccc aggctcccca

         1381 gcaggcagaa gtatgcaaag catgcatctc aattagtcag caaccatagt cccgccccta

         1441 actccgccca tcccgcccct aactccgccc agttccgccc attctccgcc ccatggctga

         1501 ctaatttttt ttatttatgc agaggccgag gccgcctcgg cctctgagct attccagaag

         1561 tagtgaggag gcttttttgg aggcctaggc ttttgcaaaa agctgttaac agcttggcac

         1621 tggccgtcgt tttacaacgt cgtgactggg aaaaccctgg cgttacccaa cttaatcgcc

         1681 ttgcagcaca tccccctttc gccagctggc gtaatagcga agaggcccgc accgatcgcc

         1741 cttcccaaca gttgcgcagc ctgaatggcg aatggcgcct gatgcggtat tttctcctta

         1801 cgcatctgtg cggtatttca caccgcatac gtcaaagcaa ccatagtacg cgccctgtag

         1861 cggcgcatta agcgcggcgg gtgtggtggt tacgcgcagc gtgaccgcta cacttgccag

         1921 cgccctagcg cccgctcctt tcgctttctt cccttccttt ctcgccacgt tcgccggctt

         1981 tccccgtcaa gctctaaatc gggggctccc tttagggttc cgatttagtg ctttacggca

         2041 cctcgacccc aaaaaacttg atttgggtga tggttcacgt agtgggccat cgccctgata

         2101 gacggttttt cgccctttga cgttggagtc cacgttcttt aatagtggac tcttgttcca

         2161 aactggaaca acactcaacc ctatctcggg ctattctttt aatttataag ggattttgcc

         2221 gatttcggcc tattggttaa aaaatgagct gatttaacaa aaatttaacg cgaattttaa

         2281 caaaatatta acgtttacaa ttttatggtg cactctcagt acaatctgct ctgatgccgc

         2341 atagttaagc cagccccgac acccgccaac acccgctgac gcgccctgac gggcttgtct

         2401 gctcccggca tccgcttaca gacaagctgt gaccgtctcc gggagctgca tgtgtcagag

         2461 gttttcaccg tcatcaccga aacgcgcgag acgaaagggc ctcgtgatac gcctattttt

         2521 ataggttaat gtcatgataa taatggtttc ttagacgtca ggtggcactt ttcggggaaa

         2581 tgtgcgcgga acccctattt gtttattttt ctaaatacat tcaaatatgt atccgctcat

         2641 gagacaataa ccctgataaa tgcttcaata atattgaaaa aggaagagta tgagtattca

         2701 acatttccgt gtcgccctta ttcccttttt tgcggcattt tgccttcctg tttttgctca

         2761 cccagaaacg ctggtgaaag taaaagatgc tgaagatcag ttgggtgcac gagtgggtta

         2821 catcgaactg gatctcaaca gcggtaagat ccttgagagt tttcgccccg aagaacgttt

         2881 tccaatgatg agcactttta aagttctgct atgtggcgcg gtattatccc gtattgacgc

         2941 cgggcaagag caactcggtc gccgcataca ctattctcag aatgacttgg ttgagtactc

         3001 accagtcaca gaaaagcatc ttacggatgg catgacagta agagaattat gcagtgctgc

         3061 cataaccatg agtgataaca ctgcggccaa cttacttctg acaacgatcg gaggaccgaa

         3121 ggagctaacc gcttttttgc acaacatggg ggatcatgta actcgccttg atcgttggga

         3181 accggagctg aatgaagcca taccaaacga cgagcgtgac accacgatgc ctgtagcaat

         3241 ggcaacaacg ttgcgcaaac tattaactgg cgaactactt actctagctt cccggcaaca

         3301 attaatagac tggatggagg cggataaagt tgcaggacca cttctgcgct cggcccttcc

         3361 ggctggctgg tttattgctg ataaatctgg agccggtgag cgtgggtctc gcggtatcat

         3421 tgcagcactg gggccagatg gtaagccctc ccgtatcgta gttatctaca cgacggggag

         3481 tcaggcaact atggatgaac gaaatagaca gatcgctgag ataggtgcct cactgattaa

         3541 gcattggtaa ctgtcagacc aagtttactc atatatactt tagattgatt taaaacttca

         3601 tttttaattt aaaaggatct aggtgaagat cctttttgat aatctcatga ccaaaatccc

         3661 ttaacgtgag ttttcgttcc actgagcgtc agaccccgta gaaaagatca aaggatcttc

         3721 ttgagatcct ttttttctgc gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc

         3781 agcggtggtt tgtttgccgg atcaagagct accaactctt tttccgaagg taactggctt

         3841 cagcagagcg cagataacca aatactgttc ttctagtgta gccgtagtta ggccaccact

         3901 tcaagaactc tgtagcaccg cctacatacc tcgctctgct aatcctgtta ccagtggctg

         3961 ctgccagtgg cgataagtcg tgtcttaccg ggttggactc aagacgatag ttaccggata

         4021 aggcgcagcg gtcgggctga acggggggtt cgtgcacaca gcccagcttg gagcgaacga

         4081 cctacaccga actgagatac ctacagcgtg agctatgaga aagcgccacg cttcccgaag

         4141 ggagaaaggc ggacaggtat ccggtaagcg gcagggtcgg aacaggagag cgcacgaggg

         4201 agcttccagg gggaaacgcc tggtatcttt atagtcctgt cgggtttcgc cacctctgac

         4261 ttgagcgtcg atttttgtga tgctcgtcag gggggcggag cctatggaaa aacgccagca

         4321 acgcggcctt tttacggttc ctggcctttt gctggccttt tgctcacatg ttctttcctg

         4381 cgttatcccc tgattctgtg gataaccgta ttaccgcctt tgagtgagct gataccgctc

         4441 gccgcagccg aacgaccgag cgcagcgagt cagtgagcga ggaagcggaa gagcgcccaa

         4501 tacgcaaacc gcctctcccc gcgcgttggc cgattcatta atgcagctgg cacgacaggt

         4561 ttcccgactg gaaagcgggc agtgagcgca acgcaattaa tgtgagttag ctcactcatt

         4621 aggcacccca ggctttacac tttatgcttc cggctcgtat gttgtgtgga attgtgagcg

         4681 gataacaatt tcacacagga aacagctatg acatgattac gaattaa

    //

     

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.