ATP2A2 (SERCA2) Polyclonal Antibody - 100 uL

https://www.gentaur.be/web/image/product.template/9836/image_1920?unique=7df116a

211,00 € 211.0 EUR 211,00 €

211,00 €

Not Available For Sale

    Deze combinatie bestaat niet.

    Terms and Conditions
    30-dagen geld terug garantie
    Verzending: 2 tot 3 weken

    Uniprot No.: P16615


    Target Name: ATP2A2


    Alternative Names: AT2A2_HUMAN antibody; Atp2a2 antibody; ATP2B antibody; ATPase Ca++ transporting cardiac muscle slow twitch 2 antibody; Calcium pump 2 antibody; Calcium-transporting ATPase sarcoplasmic reticulum type antibody; Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform antibody; Cardiac Ca2+ ATPase antibody; DAR antibody; DD antibody; Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody; MGC45367 antibody;  Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 antibody; SERCA 2 antibody; SERCA2 antibody; serca2a antibody; slow twitch skeletal muscle isoform antibody


    Raised in: Rabbit


    Species Reactivity: Human, Mouse, Rat


    Immunogen: Synthesized peptide derived from the C-terminal region of Human SERCA2.


    Immunogen sequence: CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIF


    Immunogen Species: Homo sapiens (Human)


    Conjugate: Non-conjugated


    Isotype: IgG


    Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.


    Concentration: usually 1mg/ml (Batch dependent)


    Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.


    Form: Liquid


    Tested Applications: WB, ELISA

    WB: 1:500-1:2000

    ELISA: 1:20000


    Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.


    PDF datasheet: