Recombinant Human Uncharacterized protein C1orf54 (C1orf54), E.coli expression - 20 ug

Uniprot No: Q8WWF1
Expression Region: 17-131aa (Full Length of Mature Protein)
Tag: C-terminal 6xHis-tag

Deze combinatie bestaat niet.

Neem contact met ons op voor de prijs

Terms and Conditions
30-dagen geld terug garantie
Verzending: 2 tot 3 weken

Uniprot No: Q8WWF1

Expression Region: 17-131aa (Full Length of Mature Protein)

Tag: C-terminal 6xHis-tag

Protein Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM