gene-11131.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9555/image_1920?unique=b5bc216
(0 beoordeling)

1.944,00 € 1944.0 EUR 1.944,00 € Exclusief btw

1.944,00 € Exclusief btw

Not Available For Sale

    Deze combinatie bestaat niet.

    Terms and Conditions
    30-dagen geld terug garantie
    Verzending: 2 tot 3 weken

    Expression System: E. coli

    Expression Region: Expression Region: 28-368aa;Full Length of mature protein (The 1-27aa is the signal peptide, it usually is removed during the protein expression process.)

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    DDNTPVPGDSSQISSWFQNNVKPFQQRKGSLD

    SELVQAEDDVKIIKVNINGGGDFTTITDAIKSIPAG

    NTKRVIVHIGHGVYKEKIKIERTQPFVTLHGNPQ

    SMPTLTYDGTAAKYGTVDSASLIVESDYFVAANL

    IIQNSAPRPHGQSGAQAAALRISGGKAAFFNCKI

    KGYQDTVCDDRGNHFFKDCYIEGTVDFIFGSGT

    SIYLNTQLYVLGQGNEISFITAHARDFTSETTGYSF

    IHCHISGTGHGTYLGRAWRARPRVVFSYTDMSG

    EVNPLGWSDNNHPERDSTVFFAENKCTGPGAD

    PAKRAKFAKQLSDAEAKPFLSLGFIKGSSWLLPPP

    NV