gene-12796.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9551/image_1920?unique=f82229b

1.259,00 € 1259.0 EUR 1.259,00 €

1.259,00 €

Not Available For Sale

    Deze combinatie bestaat niet.

    Terms and Conditions
    30-dagen geld terug garantie
    Verzending: 2 tot 3 weken

    Expression System: E. coli

    Expression Region: Expression Region: 1-84aa;Full Length

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    MADIAQVKAEHERIFKSFDANGDGKISSAELGD

    ALKTLGSVTAEEVKRMMAEIDTDGDGFISFQEFT

    EFASANSGLMKDVAKIF