Overslaan naar inhoud

Recombinant Pseudomonas aeruginosa Elastase(lasB), 100ug

https://www.gentaur.com.pl/web/image/product.template/2344/image_1920?unique=325b45d
(0 beoordeling)

0,00 € 0.0 EUR 0,00 € Exclusief btw

info@gentaur.com

    Deze combinatie bestaat niet.

    Algemene voorwaarden
    30-dagen geld terug garantie
    Verzending: 2 tot 3 weken

    Purity: Greater than 90% as determined by SDS-PAGE.


    Target Names: lasB


    Uniprot No.: P14756


    Alternative Names: lasB; PA3724Elastase; EC 3.4.24.26; Neutral metalloproteinase; PAE; Pseudolysin) [Cleaved into: Pro-elastase]


    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)


    Source: E.coli


    Expression Region: 198-498aa


    Target Protein Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL

    Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


    Mol. Weight: 49.1kDa


    Protein Length: Full Length of Mature Protein


    Tag Info: N-terminal 6xHis-SUMO-tagged


    Form: Liquid or Lyophilized powder

    Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.


    Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.

    Note: If you have any special requirement for the glycerol content, please remark when you place the order.

    If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.