Хypothetical protein WP_003477458 459bp pUC vector - 100ug plasmid + 200ul glycerol

https://gentaur-genprice.odoo.com/web/image/product.template/5440/image_1920?unique=8f28d63

415,00 € 415.0 EUR 415,00 €

415,00 €

Not Available For Sale

    Deze combinatie bestaat niet.

    Terms and Conditions
    30-dagen geld terug garantie
    Verzending: 2 tot 3 weken

    DNA Sequence:

    RC48GOI: atgagtccatattatagatataaaaaagaaaaatttttagaaaagtatcaatcagcaactgataacttagaagatttaaaagtagcaataaaagaatataaagatactaataatagaattataagaagagctatgtttgctttctttcaagatttcactgaatatattattgatatgtgtgaaagttatatattgataaatgatgggaaaataaagagtacaacttctgcaacacagctagttgaacaagcatatgatatgggcttttttgataatgaactaaaaaaatacttagttttatcagtgaaacttagaaatagatatactcatgattattacctaagagaagagagcgaaaaagcaatagaagaattctgttttttaaaactagcaaatctagaaatatttttagaagaaagtaaggataaagttattcttaaatataaaaatttagtttaaMSPYYRYKKE

    Protein sequence:

    KFLEKYQSATDNLEDLKVAIKEYKDTNNRIIRRAMFAFFQDFTEYIIDMC
    ESYILINDGKIKSTTSATQLVEQAYDMGFFDNELKKYLVLSVKLRNRYTHDYYLREESEKAIEEFCFLKLANLEIFLEESKDKVILKYKNLV