Skip to Content

Recombinant SARS-CoV-2 Pirola variant Spike glycoprotein (S), partial, E.coli expression, tag-free - 1 mg

(0 review)
Protein Recombinant protein
0.00 € 0.00 € (Tax excluded)

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Type: Recombinant protein

Expression system: E. coli

Species: SARS-CoV-2, Pirola variant

Tag: None

Expression Region: 315-535 aa

Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

TSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK